Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Drosophila sechellia
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_002045224.1
sequence PEP:
>XP_002045224.1
MAGMEVEFDETVGNQFSCKRCDRLCAKSFCNSGNLDRHMKVHNDVRPSCVMSARRPSPRL
Swiss-ProtZinc finger and BTB domain-containing protein 26
SUPERFAMILYSSF57667  beta-beta-alpha zinc fingers superfamily     
Gene3DG3DSA:3.30.160.60     
ProSiteProfilesPS50157  ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile.     
ProSitePatternsPS00028  ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature.     

You might be interested in these researchers

You might be interested in these references