Gene detail [Fasta]
| Species | Drosophila sechellia |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002042597.1 |
| sequence |
PEP: >XP_002042597.1 MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKK |
| Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase nonstop |
| KEGG | K11366 |
| SUPERFAMILY | SSF57850 RING/U-box superfamily |
| Gene3D | G3DSA:3.30.40.10 |
| Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
| ProSiteProfiles | PS50271 ZF_UBP; Zinc finger UBP-type profile. |
| ProSitePatterns | PS00972 USP_1; Ubiquitin specific protease (USP) domain signature 1. |
| PANTHER | PTHR24006 |
You might be interested in these researchers
You might be interested in these references
