Gene detail [Fasta]
Species | Drosophila sechellia |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002040180.1 |
sequence |
PEP: >XP_002040180.1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI |
Swiss-Prot | G protein alpha s subunit |
KEGG | K04632 GNAS; guanine nucleotide-binding protein G(s) subunit alpha |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00503 G-alpha; G-protein alpha subunit |
SMART | SM00275 |
PRINTS | PR00443 |
PANTHER | PTHR10218:SF198 |
You might be interested in these researchers

You might be interested in these references
