Gene detail [Fasta]
Species | Drosophila sechellia |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002038694.1 |
sequence |
PEP: >XP_002038694.1 MVAMRTLLNATKRSARSISAHMEAATGKSSVVMDCQDGSDETNANCLISECPSDTFRCAYGGCLAKTKVCDGEINCWDKS |
Swiss-Prot | Putative vitellogenin receptor |
SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
Gene3D | G3DSA:2.10.70.10 |
Pfam | PF00057 Ldl_recept_a; Low-density lipoprotein receptor domain class A |
SMART | SM00192 |
ProSiteProfiles | PS50068 LDLRA_2; LDL-receptor class A (LDLRA) domain profile. |
ProSitePatterns | PS01209 LDLRA_1; LDL-receptor class A (LDLRA) domain signature. |
You might be interested in these researchers

You might be interested in these references
