Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Danaus plexippus
GeneDPOGS215915
PositionDPSCF300029:492281..493336[GBrowse]
MonarchBasehttp://monarchbase.umassmed.edu/tools3/Get_gene.cgi?id=DPOGS215915
sequence mRNA:
>DPOGS215915-TA
ATGGATGTAATGGAACCTACACCGGAGGCATTACAAAGAAAATTATATTTCCTTTTAGAACAATTACAGGAAATGGCGAG
AGAATTGCCGCCCAAATACCAAATGAGGGTACCAATTGAACTCCTATCTGGGTTAGCAAACTGTCTTCTTAATGATACAG
TTTTTGAAATAGTCAAAGGTTTAATGGAAATACAACATGTTACTGAAAAGCATCTGTTTCAACAACGACTACAAATAATA
AACAAGCATACTTTAGAGATTCAAGAAATGATAAATACTACAACTCCAGAGCAACAGGAATCTAAACGGAATGTTTTATT
ACGTAGACATAAGGAAGAACTAAAACAAGCAGATATGAAATTAGTCATACAATTGGATCAAAAGGTCAGTGATCAACAAG
ATACGCTAGAAAAAGCCGGTGTTCCAGGATTCTTTGTTACGAGCAAACCTATAGAGATTAAAGTGCAAATGTATCTATTG
GACTTTATTTTAAGACTGAGTAAAATGGATATACCGCATTAA
PEP:
>DPOGS215915-PA
MDVMEPTPEALQRKLYFLLEQLQEMARELPPKYQMRVPIELLSGLANCLLNDTVFEIVKGLMEIQHVTEKHLFQQRLQII
NKHTLEIQEMINTTTPEQQESKRNVLLRRHKEELKQADMKLVIQLDQKVSDQQDTLEKAGVPGFFVTSKPIEIKVQMYLL
DFILRLSKMDIPH
Swiss-ProtGonadal protein gdl
PfamPF07324  DGCR6; DiGeorge syndrome critical region 6 (DGCR6) protein     
OrthologiGroup-00046    Gonadal protein gdl      

You might be interested in these researchers

You might be interested in these references