Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Bombyx mori
GeneBGIBMGA003152
Positionnscaf2589:4187112..4195458[GBrowse]
SilkDBhttp://www.silkdb.org/cgi-bin/gbrowse/silkdb/?name=BGIBMGA003152
sequence mRNA:
>BGIBMGA003152-TA
ATGATTGCTTTTGTCCAACAATCTGGTCCAGAGATTTTGGCCTTAAAGACTCTGATAGAGTTGTTATATCTAGCTGGTAG
TATTGCTGGATATGATGGAAACTTTACTTTTGACCGGATTGGTACTCCATATACTGACAATGTTCCTGTGAAGGCTCTCA
GGCTAGTTCCAGCTGTGTCAGGAAGTTTTCTAGTTTTAATTACATATTTTTTGATGCTAGAACTATCTTTACATCAATGG
ACTGCCATACTTGCTGCTTTATTAGTGCTCCTTGTGCGTTATGCGGACGGACGTGGCTCCTCACACCAGCAGCAAGTGAC
TTGTTACAGCTTCAAAGATGTCAACAATTGGTGGATTGTAAAACGGCCGGACCAAGCGTCGCTGGCCGTTTCGCGACCTC
CAGACGCTATAAGACACGGAGATATCGTACAACTGTTGCATGGAATAACGAGTCGCGCTTTGAATTCCCACGATGTGGCC
GCAGCTGTTTCGCCTCAATCTCAAGAAGTGTCTTGCTACATCGACTACAATGTATCGATGCCAGCTCAGAATCTTTGGCG
TGTGGATATTGTGAATCGTGATTCTGAAGAGTCAACCTGGGATAGCATACGCTCGTTAGTGAGACTTGTTCACGTTGACA
CGGGGTCGGGCTTGCGTTACAGTGGTCGCCAACTTCCGGCTTGGGGTTTCCATCAACATGAGATTGTTGCTGACAAGGTG
TTATCCCATCAAGATACAATATGGAATGTTGAAGAGCATCGCTATACCAAAGGTTTTTTTTTCAATTCGTCTTTATTTGT
TCTATATTTTTCCAAGGAGCTCAATTTCAATTTATGTTTTGTTTCAGCCGATGATCGAAAAGAACGGGAACGCGAGTTAG
TCACGGCTGAAATGATACCGACTGCAGTGACCCAATTAACTTTTTGGGAAAAATTTACAGAATTACAATATAAAATGATA
GCACACGCACCTGATGCCCCTCACGGGCACATGTTTGCCAGCGAACCAGCTGAATGGCCTCTGCTTGTTCGTTCAATTGC
ATATTGGCTCTCTCCTGACTCTAATGCTCAAATACATCTGATAGGCAACATTGTAACATGGTATACTGGGACAATATCGG
TAGTAGTCTACAGTGCCCTCCTGGCTATTTACTCCGTTCGAAAACGTCGAGCTTGTGAAGACTTGCCTCCATTTGTTTTG
AATAAGTTTTATGAAACTGGCTATACATTATTTCTAGGTTATTGGTTACATTACCTACCTTACTTTTTTATAGATCGAAC
TCTGTTCCTTCATCATTATTTACCTGCATATATTTTTAAGATTCTTCTTTTGGCTTATATTATGGATCATATTTACTTAG
TTTTACAGCTCCATGAGAAAACTAAACATGTTACAAATTTATTTATATTATGTGTAACAATATGGCTGTCATATATCGTG
CTTACATTTAAAAAATTCAGTGTTCTGAACTATGGAAATGTTGATTTAAAGGAAAATGATCTAATGAGTCTTAGGTGGAA
AGATACCTGGGACTTTATATTACATAAAAAGATATAA
PEP:
>BGIBMGA003152-PA
MIAFVQQSGPEILALKTLIELLYLAGSIAGYDGNFTFDRIGTPYTDNVPVKALRLVPAVSGSFLVLITYFLMLELSLHQW
TAILAALLVLLVRYADGRGSSHQQQVTCYSFKDVNNWWIVKRPDQASLAVSRPPDAIRHGDIVQLLHGITSRALNSHDVA
AAVSPQSQEVSCYIDYNVSMPAQNLWRVDIVNRDSEESTWDSIRSLVRLVHVDTGSGLRYSGRQLPAWGFHQHEIVADKV
LSHQDTIWNVEEHRYTKGFFFNSSLFVLYFSKELNFNLCFVSADDRKERERELVTAEMIPTAVTQLTFWEKFTELQYKMI
AHAPDAPHGHMFASEPAEWPLLVRSIAYWLSPDSNAQIHLIGNIVTWYTGTISVVVYSALLAIYSVRKRRACEDLPPFVL
NKFYETGYTLFLGYWLHYLPYFFIDRTLFLHHYLPAYIFKILLLAYIMDHIYLVLQLHEKTKHVTNLFILCVTIWLSYIV
LTFKKFSVLNYGNVDLKENDLMSLRWKDTWDFILHKKI
Swiss-ProtProtein O-mannosyltransferase 1
KEGG     K00728  POMT; dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]     
SUPERFAMILYSSF82109  MIR domain superfamily     
Gene3DG3DSA:2.80.10.50     
PfamPF02366  PMT; Dolichyl-phosphate-mannose-protein mannosyltransferase      
SMARTSM00472     
ProSiteProfilesPS50919  MIR; MIR domain profile.     
OrthologiGroup-00056    Protein O-mannosyltransferase     

You might be interested in these researchers

You might be interested in these references