Gene detail [Fasta]
Species | Drosophila grimshawi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001993440.1 |
sequence |
PEP: >XP_001993440.1 MKLIGLMLALCLQLSVFVSGQEDLKTEAPKSKCLCTYRNTPVCASNSITYPNYCSFDCARRELESSGDGLFIVKRGRC |
Swiss-Prot | Serine protease inhibitor Kazal-type 6 |
SUPERFAMILY | SSF100895 Kazal-type serine protease inhibitors superfamily |
Gene3D | G3DSA:3.30.60.30 |
Pfam | PF07648 Kazal_2; Kazal-type serine protease inhibitor domain |
SMART | SM00280 |
ProSiteProfiles | PS51465 KAZAL_2; Kazal domain profile. |
ProSitePatterns | PS00282 KAZAL_1; Kazal serine protease inhibitors family signature. |
You might be interested in these researchers

You might be interested in these references
