Gene detail [Fasta]
| Species | Drosophila grimshawi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001990323.1 |
| sequence |
PEP: >XP_001990323.1 MRREYNSYSDLSRHFRLYDEQSMDSLQDDHLRIHMNPNGSDDGSLQHVDCYSSIYLPTYPLLRHHNFKLKSYYSNVGNCV |
| Swiss-Prot | GTPase-activating protein RacGAP84C |
| KEGG | K16733 |
| SUPERFAMILY | SSF57889 Cysteine-rich domain superfamily |
| Gene3D | G3DSA:1.10.555.10 |
| Pfam | PF00620 RhoGAP; RhoGAP domain |
| SMART | SM00109 |
| ProSiteProfiles | PS50238 RHOGAP; Rho GTPase-activating proteins domain profile. |
| ProSitePatterns | PS00479 ZF_DAG_PE_1; Zinc finger phorbol-ester/DAG-type signature. |
| PANTHER | PTHR23174 |
You might be interested in these researchers
You might be interested in these references
