Gene detail [Fasta]
Species | Drosophila grimshawi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001990057.1 |
sequence |
PEP: >XP_001990057.1 MPLKVNLFLILAVSLAWLLLPELAQGMGLHRSVAVDVDECNFDFKEQPEDFYGMLDAIQLPLTTPMDTIRTMRHINQRRK |
Swiss-Prot | Dorsal-ventral patterning protein tolloid |
KEGG | K13045 |
SUPERFAMILY | SSF49854 Spermadhesin, CUB domain superfamily |
Gene3D | G3DSA:3.40.390.10 |
Pfam | PF14670 FXa_inhibition; Coagulation Factor Xa inhibitory site |
SMART | SM00235 |
ProSiteProfiles | PS01180 CUB; CUB domain profile. |
PRINTS | PR00480 |
ProSitePatterns | PS00010 ASX_HYDROXYL; Aspartic acid and asparagine hydroxylation site. |
PIRSF | PIRSF001199 |
PANTHER | PTHR10127:SF304 |
You might be interested in these researchers

You might be interested in these references
