Gene detail [Fasta]
Species | Tribolium castaneum |
---|---|
Gene | TCOGS2:TC012627 |
Position | ChLG9:16658607..16658977[GBrowse] |
sequence |
mRNA: >TCOGS2:TC012627-RA ATGTCTCTGGATGAGAGATTCAAAAAAGCAGCGGACGACGTGCAAAAACTAAAATCAAAGCCTTCCAACGATGACTTGTTPEP: >TCOGS2:TC012627-PA MSLDERFKKAADDVQKLKSKPSNDDLLEIYALFKQGSVGDCNTDRPGMLDLKGKAKWDAWNGKKGMSQDKAKEEYIAKVE |
Swiss-Prot | Putative acyl-CoA-binding protein |
KEGG | K08762 DBI, ACBP; diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) |
SUPERFAMILY | SSF47027 Acyl-CoA binding protein superfamily |
Gene3D | G3DSA:1.20.80.10 |
Pfam | PF00887 ACBP; Acyl CoA binding protein |
ProSiteProfiles | PS51228 ACB_2; Acyl-CoA-binding (ACB) domain profile. |
PRINTS | PR00689 |
ProSitePatterns | PS00880 ACB_1; Acyl-CoA-binding (ACB) domain signature. |
Ortholog | iGroup-00883 Putative acyl-CoA-binding protein |
You might be interested in these researchers

You might be interested in these references
