Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Tribolium castaneum
GeneTCOGS2:TC010901
PositionChLG5:2121007..2122503[GBrowse]
sequence mRNA:
>TCOGS2:TC010901-RA
ATGACGAGGATATTACTTCCGTTTATCCTCATCGCTTTCGTCCGCGGAGAAACCTCGGTCTACATCCTCTCCGAAAATTT
AGAACAAGTGGTAACTTCGACAACCCTCCAGTGGGTGCACTCGTCCAGTATCAACGAAACCACCCTTGGCAATGCCGTCA
TCGCAGCCTTGCAAGTAGTCAAGGATCCCGACAATCCCGAAGAACCCATCGGCAGCAAACCGGTCTACGTTTGCCGCGCC
AGAACCAACTACGTGTGGGTCTCAGGCCAGTTGAGGCCCAAATCCAAAGTATGCATCGTATCCATGTACAAGAAAGTCTC
CGAACACCCAAATTTCGAAGTGTTGATAAACGTCGAAAACAGCGCTCGCCTCAGCTGGGTGTACAAAGACAAATACGTAA
CTGCAAACCTCGCCGGAGGTGTTACAAGTGGCGAGGGTCGTGAAGGACCCCTCGAAAGGACTTTCATCGCCAGACACGAA
ACCAACAACCATAACAAACTCGGTTCTTTGAACTATCACGTTGGGAAATTTAATCCGGGCGAAAACCTGGGTGTTTTCCA
CGTCGTAGATCAGAACAACAACGAGATCACACACGAAATGGGGCAGATTTTAGTCGAGACGGAACCCATCAGATACGAAT
TCAAGTCCGTCAAGTTCGACAGGATTCGTGCCAAACACCACAAGAAAAAAATGGTTTTGGGGCACGCAACTTTGAAGAAC
ACTGAACGCGGCGTGCAGCGAGTTGACACCGTCATCAGTTACAACTACACCTACTCCATTTATTGGGGCAAAGCGCACGG
ACTTTTAACCGGCCTCAACTTCACCGTGTCTCTCCCAGACGGCGTGAAAACAGGCACCTGGGCCCTGCCTAAGAGCGAAA
ACGTGGTCGACACCAAAACCATCGAGAAGTACCTGGATGAAGGCACCGCTGTCAACGTCACACTCTGGGGCAACTACACC
GACTCGGACGTGCCCTACACTGCCACCGTTTACGCAGTGTACAAAGATAAGGAACAATTACCTCGGCCAATATTTGACAA
CAAACGCGAACGCCTGATAACGGATGTGTCCATCGAGTTCGGTCCTGTGTACTTCTTGCACAACAACAGTCACGTCCCTA
CCACCACCACCACGACCACTACGACAACAACCACGACGTCAGCGACCACCAGTAGGACAAAATCAACGACTCATAAGGTC
GTTCCGTTGGAGATTCCCTCAGTTGTGCAAGTTGGAAATTCGGAGAAACACCCCGATGAAGCCTCGGCGATCAAAATCCA
CGAGAACAGCAGCATGATGTCGGACGCCAGCAACGCCGAGTCCGAAATTGCGACGTCAACGACGAAGAAAAACACGCTGA
AAGCCAGCTCTTCAACGCGAGTCCTCGCCGATTTGGTGCTGTTGGGGGCGGTGTCGCTGATTGTGCGTCGGGTGACGTAA

PEP:
>TCOGS2:TC010901-PA
MTRILLPFILIAFVRGETSVYILSENLEQVVTSTTLQWVHSSSINETTLGNAVIAALQVVKDPDNPEEPIGSKPVYVCRA
RTNYVWVSGQLRPKSKVCIVSMYKKVSEHPNFEVLINVENSARLSWVYKDKYVTANLAGGVTSGEGREGPLERTFIARHE
TNNHNKLGSLNYHVGKFNPGENLGVFHVVDQNNNEITHEMGQILVETEPIRYEFKSVKFDRIRAKHHKKKMVLGHATLKN
TERGVQRVDTVISYNYTYSIYWGKAHGLLTGLNFTVSLPDGVKTGTWALPKSENVVDTKTIEKYLDEGTAVNVTLWGNYT
DSDVPYTATVYAVYKDKEQLPRPIFDNKRERLITDVSIEFGPVYFLHNNSHVPTTTTTTTTTTTTTSATTSRTKSTTHKV
VPLEIPSVVQVGNSEKHPDEASAIKIHENSSMMSDASNAESEIATSTTKKNTLKASSSTRVLADLVLLGAVSLIVRRVT
Swiss-ProtProtein unzipped
PfamPF11901  DUF3421; Protein of unknown function (DUF3421)     
OrthologiGroup-00058    Protein unzipped      

You might be interested in these researchers

You might be interested in these references