Gene detail [Fasta]
Species | Tribolium castaneum |
---|---|
Gene | TCOGS2:TC003102 |
Position | ChLG3:2270761..2270877[GBrowse] |
sequence |
mRNA: >TCOGS2:TC003102-RA ATGAATGTCGAGTGCGGCAAAGAGAGACACCTCAAATGTAACCGGTGTAACGCCAGTTTTTATTACAAACAGGACCTGCGPEP: >TCOGS2:TC003102-PA MNVECGKERHLKCNRCNASFYYKQDLRKHLARMHGRLM |
Swiss-Prot | Zinc finger and BTB domain-containing protein 26 |
SUPERFAMILY | SSF57667 beta-beta-alpha zinc fingers superfamily |
Gene3D | G3DSA:3.30.160.60 |
ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers

You might be interested in these references
