Gene detail [Fasta]
Species | Drosophila yakuba |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002100765.1 |
sequence |
PEP: >XP_002100765.1 MADLIHLGNIDVVIQKDKPGSPTGCSDDGNLAGLGGMTGLGGIMAPGGIDLGDLAQELDHDEFDGPHMLNGERPAIIAPP |
Swiss-Prot | Ras GTPase-activating protein 1 |
KEGG | K04352 RASA1, RASGAP; Ras GTPase-activating protein 1 |
SUPERFAMILY | SSF48350 GTPase activation domain, GAP superfamily |
Gene3D | G3DSA:1.10.506.10 |
Pfam | PF00017 SH2; SH2 domain |
SMART | SM00233 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
PRINTS | PR00401 |
Coils | Coil |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
PANTHER | PTHR10194:SF19 |
You might be interested in these researchers

You might be interested in these references
