Gene detail [Fasta]
| Species | Drosophila yakuba |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002097959.1 |
| sequence |
PEP: >XP_002097959.1 MDSTSASVVYANAFYAPNYPDTQQSQPQPQPPPPPPPQLQSQQQQHQSQMFHGSFMVRSALGSGLGLGLGPAPNPQASAS |
| Swiss-Prot | TATA-binding protein-associated factor 2N |
| SUPERFAMILY | SSF90209 Ran binding protein zinc finger-like superfamily |
| Gene3D | G3DSA:4.10.1060.10 |
| Pfam | PF00641 zf-RanBP; Zn-finger in Ran binding protein and others |
| SMART | SM00360 |
| ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
| ProSitePatterns | PS01358 ZF_RANBP2_1; Zinc finger RanBP2-type signature. |
| PANTHER | PTHR23111:SF26 |
You might be interested in these researchers
You might be interested in these references
