Gene detail [Fasta]
Species | Drosophila yakuba |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002094256.1 |
sequence |
PEP: >XP_002094256.1 MLLKKKRYMFDERDDDNINSPVAVEPSSNNNKMADTREVRIEEQLKVKIGEAKNLSSRNAANTSCSTQGTRDVYCTIALD |
Swiss-Prot | GTPase-activating protein |
KEGG | K12380 RASA3; Ras GTPase-activating protein 3 |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00616 RasGAP; GTPase-activator protein for Ras-like GTPase |
SMART | SM00107 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
Coils | Coil |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
PANTHER | PTHR10194:SF87 |
You might be interested in these researchers

You might be interested in these references
