Gene detail [Fasta]
Species | Drosophila yakuba |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002092343.1 |
sequence |
PEP: >XP_002092343.1 MQVPEHVVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASS |
Swiss-Prot | RNA-binding protein fusilli |
KEGG | K14947 |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:3.30.420.10 |
Pfam | PF14259 RRM_6; RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) |
SMART | SM00360 |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
PANTHER | PTHR13976:SF25 |
You might be interested in these researchers

You might be interested in these references
