Gene detail [Fasta]
Species | Drosophila yakuba |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002088979.1 |
sequence |
PEP: >XP_002088979.1 MPEDNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSVSRNEPFEFPLGKGNVIKAFDMGVATMK |
Swiss-Prot | FK506-binding protein 59 |
KEGG | K09571 FKBP4_5; FK506-binding protein 4/5 [EC:5.2.1.8] |
SUPERFAMILY | SSF48452 TPR-like superfamily |
Gene3D | G3DSA:1.25.40.10 |
Pfam | PF00254 FKBP_C; FKBP-type peptidyl-prolyl cis-trans isomerase |
SMART | SM00028 |
ProSiteProfiles | PS50293 TPR_REGION; TPR repeat region circular profile. |
Coils | Coil |
PANTHER | PTHR10516:SF274 |
You might be interested in these researchers

You might be interested in these references
