Gene detail [Fasta]
| Species | Ceratosolen solmsi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011506001.1 |
| sequence |
PEP: >XP_011506001.1 MSTILERIAAIEAEMARTQKNKATSGHLGLLKAKLAKLRRELITPKGGGSSGEQGFEVAKTGDARIGFVGFPSVGKSTLL |
| Swiss-Prot | GTP-binding protein 128up |
| SUPERFAMILY | SSF81271 TGS-like superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF02824 TGS; TGS domain |
| ProSiteProfiles | PS51710 G_OBG; OBG-type guanine nucleotide-binding (G) domain profile. |
| PRINTS | PR00326 |
| Coils | Coil |
| ProSitePatterns | PS00905 GTP1_OBG; GTP1/OBG family signature. |
| TIGRFAM | TIGR00231 |
| PANTHER | PTHR11702 |
You might be interested in these researchers
You might be interested in these references
