Gene detail [Fasta]
Species | Ceratosolen solmsi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011504031.1 |
sequence |
PEP: >XP_011504031.1 MNDKKELLHLRDIGFRTGENIILLHVGFSLSPGEFKLITGPSGCGKSTLLKIVASLLSPTEGTLLFEGQDIASLSPESYR |
Swiss-Prot | Probable iron export ATP-binding protein FetA |
KEGG | K02068 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF03649 UPF0014; Uncharacterised protein family (UPF0014) |
SMART | SM00382 |
ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
PANTHER | PTHR24220:SF410 |
You might be interested in these researchers

You might be interested in these references
