Gene detail [Fasta]
Species | Ceratosolen solmsi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011502913.1 |
sequence |
PEP: >XP_011502913.1 MPGLIAVSDFIEETRGDYNSPTTSTFVSRMPQCRQTIAALEETLDFDRDGLTKLKKAIKAIYNSGNAHVDNEMYLGRALE |
Swiss-Prot | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 |
KEGG | K12488 ASAP; Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF57863 ArfGap/RecO-like zinc finger superfamily |
Gene3D | G3DSA:2.30.30.40 |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00326 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00452 |
Coils | Coil |
PANTHER | PTHR23180:SF17 |
You might be interested in these researchers

You might be interested in these references
