Gene detail [Fasta]
Species | Ceratosolen solmsi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011499606.1 |
sequence |
PEP: >XP_011499606.1 MSVPPSSSKGIASVKPGGTSPSPIEGVEGVPGPSTLEQIPLPQNEELDDYGETADEEEEESTEEDCEISDSGLFCDAECE |
Swiss-Prot | F-box/WD repeat-containing protein 7 |
KEGG | K10260 FBXW7, SEL10; F-box and WD-40 domain protein 7 |
SUPERFAMILY | SSF81383 F-box domain superfamily |
Gene3D | G3DSA:1.20.1280.50 |
Pfam | PF12937 F-box-like; F-box-like |
SMART | SM00320 |
ProSiteProfiles | PS50181 FBOX; F-box domain profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
PANTHER | PTHR22844:SF116 |
You might be interested in these researchers

You might be interested in these references
