Gene detail [Fasta]
Species | Ceratosolen solmsi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011495823.1 |
sequence |
PEP: >XP_011495823.1 MVYLTCILGYAKKKSIPMRNYLMSGFFDKLRFHIRAGTGGSGLSKYGGRGGRGGNIYVKSKDNVSLKDLSKYVRNNTIVA |
Swiss-Prot | GTP-binding protein 10 homolog |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF01926 MMR_HSR1; 50S ribosome-binding GTPase |
ProSiteProfiles | PS51710 G_OBG; OBG-type guanine nucleotide-binding (G) domain profile. |
PRINTS | PR00326 |
Coils | Coil |
PIRSF | PIRSF002401 |
PANTHER | PTHR11702:SF25 |
You might be interested in these researchers

You might be interested in these references
