Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012153860.1 |
sequence |
PEP: >XP_012153860.1 MAEETRLVRVEERLKIKIGEVKNLQGRSHGSPGARDVYCTLSLDQEEIFRTATMERTLSPFFGEEFQFEVPRKFRYLGIY |
Swiss-Prot | Ras GTPase-activating protein 3 |
KEGG | K12380 RASA3; Ras GTPase-activating protein 3 |
SUPERFAMILY | SSF48350 GTPase activation domain, GAP superfamily |
Gene3D | G3DSA:2.60.40.150 |
Pfam | PF00779 BTK; BTK motif |
SMART | SM00233 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
PANTHER | PTHR10194:SF53 |
You might be interested in these researchers

You might be interested in these references
