Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012152643.1 |
sequence |
PEP: >XP_012152643.1 MYENVCSINAVSCLCHTCKTYKDRLHSCLHCIFFGCYVKGHIQEHAKTKKHFLAVDLCYGNILCFQCGDYVYDRELLTVA |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 22 |
KEGG | K11366 |
SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
ProSiteProfiles | PS50271 ZF_UBP; Zinc finger UBP-type profile. |
ProSitePatterns | PS00972 USP_1; Ubiquitin specific protease (USP) domain signature 1. |
PANTHER | PTHR24006:SF347 |
You might be interested in these researchers

You might be interested in these references
