Gene detail [Fasta]
| Species | Megachile rotundata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012149313.1 |
| sequence |
PEP: >XP_012149313.1 MTMKSKKHDLKGFKTMWIQFAKKSIDKHQLFFKEHSVRHQLPEHPRGRTLFVLNIPPYVTAEALQTVFSEIFGNVTDIFF |
| Swiss-Prot | Ribosomal RNA-processing protein 7 homolog A |
| KEGG | K14545 RRP7; ribosomal RNA-processing protein 7 |
| SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
| Gene3D | G3DSA:3.30.70.330 |
| Pfam | PF00076 RRM_1; RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
| SMART | SM00360 |
| ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
| Coils | Coil |
| PANTHER | PTHR13191 |
You might be interested in these researchers
You might be interested in these references
