Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012146025.1 |
sequence |
PEP: >XP_012146025.1 MQSSSTEGGIPQRAVDGSNGQIYTPQTCTLTRPENRPWWYVNLLEPYMVQLVRLDFGKPCCGDGVSGTIVVRVGNNRPDL |
Swiss-Prot | Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 |
SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
Gene3D | G3DSA:3.10.100.10 |
Pfam | PF00059 Lectin_C; Lectin C-type domain |
SMART | SM00032 |
ProSiteProfiles | PS50041 C_TYPE_LECTIN_2; C-type lectin domain profile. |
ProSitePatterns | PS00615 C_TYPE_LECTIN_1; C-type lectin domain signature. |
PANTHER | PTHR19325:SF339 |
You might be interested in these researchers

You might be interested in these references
