Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012145544.1 |
sequence |
PEP: >XP_012145544.1 MMKSLVGIMWIVLVLISGCSGNPDAKRLYDDLLSNYNKLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLWVEQS |
Swiss-Prot | Acetylcholine receptor subunit alpha-like |
SUPERFAMILY | SSF63712 Nicotinic receptor ligand binding domain-like superfamily |
Gene3D | G3DSA:1.20.120.370 |
Pfam | PF02932 Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region |
ProSiteProfiles | PS51257 PROKAR_LIPOPROTEIN; Prokaryotic membrane lipoprotein lipid attachment site profile. |
PRINTS | PR00254 |
ProSitePatterns | PS00236 NEUROTR_ION_CHANNEL; Neurotransmitter-gated ion-channels signature. |
PANTHER | PTHR18945:SF473 |
You might be interested in these researchers

You might be interested in these references
