Gene detail [Fasta]
| Species | Megachile rotundata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012142352.1 |
| sequence |
PEP: >XP_012142352.1 MTSAKIEFAVNMTCQNCVETVRKSLTGVNGIDNIDISLEKGNVVVETSLPYSVIQEKIEKSGKKAVLKGYGDNSSAVAML |
| Swiss-Prot | Copper chaperone for superoxide dismutase |
| KEGG | K04569 CCS; copper chaperone for superoxide dismutase |
| SUPERFAMILY | SSF49329 Cu,Zn superoxide dismutase-like superfamily |
| Gene3D | G3DSA:3.30.70.100 |
| Pfam | PF00403 HMA; Heavy-metal-associated domain |
| ProSiteProfiles | PS50846 HMA_2; Heavy-metal-associated domain profile. |
| PRINTS | PR00068 |
| ProSitePatterns | PS00087 SOD_CU_ZN_1; Copper/Zinc superoxide dismutase signature 1. |
| PANTHER | PTHR10003 |
You might be interested in these researchers
You might be interested in these references
