Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012135488.1 |
sequence |
PEP: >XP_012135488.1 MPGLIAVSEFVEETREDYNSPTTSTFVSRMPQCRQTITSLEETLDFDRDGLTKLKKAIKAIHNSGNAHVDNEVYLGRALE |
Swiss-Prot | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 |
KEGG | K12488 ASAP; Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF48403 Ankyrin repeat superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF00379 Chitin_bind_4; Insect cuticle protein |
SMART | SM00233 |
ProSiteProfiles | PS50297 ANK_REP_REGION; Ankyrin repeat region circular profile. |
PRINTS | PR00405 |
Coils | Coil |
ProSitePatterns | PS00233 CHIT_BIND_RR_1; Chitin-binding type R&R domain signature. |
PANTHER | PTHR23180:SF17 |
You might be interested in these researchers

You might be interested in these references
