Gene detail [Fasta]
Species | Megachile rotundata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003701261.1 |
sequence |
PEP: >XP_003701261.1 MDLGNGRKSCDKSFDTDDDSDYAIIKRIKMEPEAILSQEDDIMAQLQQESSDLEVEPSFALEGTVNGEDCNEGVLMQHMD |
Swiss-Prot | DNA-binding protein Ets97D |
KEGG | K09441 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.10.10.10 |
Pfam | PF11620 GABP-alpha; GA-binding protein alpha chain |
SMART | SM00251 |
ProSiteProfiles | PS51433 PNT; Pointed (PNT) domain profile. |
PRINTS | PR00454 |
Coils | Coil |
ProSitePatterns | PS00345 ETS_DOMAIN_1; Ets-domain signature 1. |
PANTHER | PTHR11849:SF28 |
You might be interested in these researchers

You might be interested in these references
