Gene detail [Fasta]
| Species | Megachile rotundata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003701232.1 |
| sequence |
PEP: >XP_003701232.1 MSLDEKFNKAAEEVKELSSQPSDADLLELYSLFKQASVGDCNTSRPGMLDFKGKAKWDAWDRIKGMDQNTAKEKYIQKVE |
| Swiss-Prot | Acyl-CoA-binding protein |
| KEGG | K08762 DBI, ACBP; diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) |
| SUPERFAMILY | SSF47027 Acyl-CoA binding protein superfamily |
| Gene3D | G3DSA:1.20.80.10 |
| Pfam | PF00887 ACBP; Acyl CoA binding protein |
| ProSiteProfiles | PS51228 ACB_2; Acyl-CoA-binding (ACB) domain profile. |
| PRINTS | PR00689 |
| ProSitePatterns | PS00880 ACB_1; Acyl-CoA-binding (ACB) domain signature. |
| PANTHER | PTHR23310 |
You might be interested in these researchers
You might be interested in these references
