Gene detail [Fasta]
| Species | Fopius arisanus |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011314778.1 |
| sequence |
PEP: >XP_011314778.1 MPSADVAMLVDMGFTLSKAEKALQMTGNKGVEPAMEWLLAHSDDGEPSAESLEVQASGSAPPEEAKSSEATEESATEAKS |
| Swiss-Prot | UBX domain-containing protein 1-A |
| SUPERFAMILY | SSF54236 Ubiquitin-like superfamily |
| Gene3D | G3DSA:1.10.8.10 |
| Pfam | PF00789 UBX; UBX domain |
| SMART | SM00165 |
| ProSiteProfiles | PS50030 UBA; Ubiquitin-associated domain (UBA) profile. |
| Coils | Coil |
| ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
| PANTHER | PTHR13020:SF25 |
You might be interested in these researchers
You might be interested in these references
