Gene detail [Fasta]
| Species | Fopius arisanus |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011298871.1 |
| sequence |
PEP: >XP_011298871.1 MIIPSRFRMDVAGNLSLIKEKIRIACSKRSPDLANVTPRLVAVSKTKPPDLIISALDAGQKNFGENYVNELVEKGNHPDL |
| Swiss-Prot | Proline synthase co-transcribed bacterial homolog protein |
| KEGG | K06997 |
| SUPERFAMILY | SSF51419 PLP-binding barrel superfamily |
| Gene3D | G3DSA:3.20.20.10 |
| Pfam | PF01168 Ala_racemase_N; Alanine racemase, N-terminal domain |
| ProSitePatterns | PS01211 UPF0001; Uncharacterized protein family UPF0001 signature. |
| PIRSF | PIRSF004848 |
| TIGRFAM | TIGR00044 |
| PANTHER | PTHR10146 |
You might be interested in these researchers
You might be interested in these references
