Gene detail [Fasta]
Species | Drosophila persimilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002028074.1 |
sequence |
PEP: >XP_002028074.1 MSPPPAAIIHCLISDVGHSQNAFALGKVLNNRMVVYKQKKMSLKPDDKCSICKVVKTDPVSAHCGHSFCWVCINEYLLAT |
Swiss-Prot | Tripartite motif-containing protein 5 |
SUPERFAMILY | SSF57850 RING/U-box superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF00097 zf-C3HC4; Zinc finger, C3HC4 type (RING finger) |
SMART | SM00184 |
ProSiteProfiles | PS50089 ZF_RING_2; Zinc finger RING-type profile. |
ProSitePatterns | PS00518 ZF_RING_1; Zinc finger RING-type signature. |
PANTHER | PTHR24103:SF47 |
You might be interested in these researchers

You might be interested in these references
