Gene detail [Fasta]
Species | Drosophila persimilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002020427.1 |
sequence |
PEP: >XP_002020427.1 MPGGWWMGTLKATGKTGMFPDNFVRVLDTNGSTNGNGEHIDDGTAVQLRDKSETSNRRVKVVYSYTQVNDDELTLTMGDV |
Swiss-Prot | SH3 domain-containing kinase-binding protein 1 |
KEGG | K13738 CD2AP; CD2-associated protein |
SUPERFAMILY | SSF50044 SH3-domain superfamily |
Gene3D | G3DSA:2.30.30.40 |
Pfam | PF14604 SH3_9; Variant SH3 domain |
SMART | SM00326 |
ProSiteProfiles | PS50002 SH3; Src homology 3 (SH3) domain profile. |
PRINTS | PR00452 |
PANTHER | PTHR14167:SF19 |
You might be interested in these researchers

You might be interested in these references
