Gene detail [Fasta]
Species | Drosophila pseudoobscura |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003736501.1 |
sequence |
PEP: >XP_003736501.1 MDKNLMMPKRSRIDVKGTFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII |
Swiss-Prot | C-terminal-binding protein |
KEGG | K04496 CTBP; C-terminal binding protein |
SUPERFAMILY | SSF51735 NAD(P)-binding Rossmann-fold domains superfamily |
Gene3D | G3DSA:3.40.50.720 |
Pfam | PF00389 2-Hacid_dh; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
ProSitePatterns | PS00671 D_2_HYDROXYACID_DH_3; D-isomer specific 2-hydroxyacid dehydrogenases signature 3. |
PANTHER | PTHR10996:SF91 |
You might be interested in these researchers

You might be interested in these references
