Gene detail [Fasta]
Species | Drosophila pseudoobscura |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002137693.2 |
sequence |
PEP: >XP_002137693.2 MTFPPAELSVDEDVDVDVEVDGDGDAEQLIIEEYKIWKKNTPYMYDEIVTHALEWPSLTAQWLPGASGQDGKEYSVHRLI |
Swiss-Prot | Probable histone-binding protein Caf1 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
PANTHER | PTHR22850:SF82 |
You might be interested in these researchers

You might be interested in these references
