Gene detail [Fasta]
| Species | Drosophila pseudoobscura |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001357398.1 |
| sequence |
PEP: >XP_001357398.1 MTTKHMYSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATFFTNRALCNLKLKRWELCCQDCRRALDIDAN |
| Swiss-Prot | STIP1 homology and U box-containing protein 1 |
| KEGG | K09561 STUB1, CHIP; STIP1 homology and U-box containing protein 1 [EC:6.3.2.19] |
| SUPERFAMILY | SSF48452 TPR-like superfamily |
| Gene3D | G3DSA:1.25.40.10 |
| Pfam | PF04564 U-box; U-box domain |
| SMART | SM00028 |
| ProSiteProfiles | PS50005 TPR; TPR repeat profile. |
| Coils | Coil |
| PANTHER | PTHR22904:SF305 |
You might be interested in these researchers
You might be interested in these references
