Gene detail [Fasta]
| Species | Drosophila pseudoobscura |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001356963.1 |
| sequence |
PEP: >XP_001356963.1 MKFLCILVALCLLLALAIAPIQADDDLSAEKDGQTLRKFCPCPRNYDPVCASNMVTYPNRCEYDCVRREAERRGRNLGFL |
| Swiss-Prot | Serine protease inhibitor Kazal-type 2 |
| SUPERFAMILY | SSF100895 Kazal-type serine protease inhibitors superfamily |
| Gene3D | G3DSA:3.30.60.30 |
| Pfam | PF00050 Kazal_1; Kazal-type serine protease inhibitor domain |
| SMART | SM00280 |
| ProSiteProfiles | PS51465 KAZAL_2; Kazal domain profile. |
| ProSitePatterns | PS00282 KAZAL_1; Kazal serine protease inhibitors family signature. |
You might be interested in these researchers
You might be interested in these references
