Gene detail [Fasta]
Species | Athalia rosae |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012261392.1 |
sequence |
PEP: >XP_012261392.1 MPFFKKLRRFSPKHKKLCEEWALASSRECVEGGGGGCGGQEDAEDPAEATFTLKYLGSTLVETPSSEEATAEAIKTIITM |
Swiss-Prot | Low density lipoprotein receptor adapter protein 1-B |
KEGG | K12474 LDLRAP1, ARH; low density lipoprotein receptor adapter protein 1 |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00640 PID; Phosphotyrosine interaction domain (PTB/PID) |
SMART | SM00462 |
ProSiteProfiles | PS01179 PID; Phosphotyrosine interaction domain (PID) profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
