Gene detail [Fasta]
Species | Drosophila simulans |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002082420.1 |
sequence |
PEP: >XP_002082420.1 MKLVSIWALAALCLCLGQVASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHISYTFFGISDAGEFKSLDTWLDMDD |
Swiss-Prot | Acidic mammalian chitinase |
KEGG | K01183 E3.2.1.14; chitinase [EC:3.2.1.14] |
SUPERFAMILY | SSF54556 Chitinase insertion domain superfamily |
Gene3D | G3DSA:2.170.140.10 |
Pfam | PF00704 Glyco_hydro_18; Glycosyl hydrolases family 18 |
SMART | SM00494 |
ProSiteProfiles | PS50940 CHIT_BIND_II; Chitin-binding type-2 domain profile. |
ProSitePatterns | PS01095 CHITINASE_18; Chitinases family 18 active site. |
PANTHER | PTHR11177:SF112 |
You might be interested in these researchers

You might be interested in these references
