Gene detail [Fasta]
Species | Drosophila simulans |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002082080.1 |
sequence |
PEP: >XP_002082080.1 MSSSGIVLYGADLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYLKKNPQHTVPVLDDNGTFIWDSHAIAAYLVDK |
Swiss-Prot | Glutathione S-transferase 1 |
KEGG | K00799 GST, gst; glutathione S-transferase [EC:2.5.1.18] |
SUPERFAMILY | SSF47616 GST C-terminal domain-like superfamily |
Gene3D | G3DSA:3.40.30.10 |
Pfam | PF00043 GST_C; Glutathione S-transferase, C-terminal domain |
ProSiteProfiles | PS50405 GST_CTER; Soluble glutathione S-transferase C-terminal domain profile. |
PANTHER | PTHR11260:SF162 |
You might be interested in these researchers

You might be interested in these references
