Gene detail [Fasta]
| Species | Drosophila simulans |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002078045.1 |
| sequence |
PEP: >XP_002078045.1 MILFWAIVLISSVDRTNARCQESVHLEHGSSEIVNGSIVFHCDQGYFLQGSKVFACDRGIPRGKKPFCAKSGCQEYEQIQ |
| Swiss-Prot | MAM and LDL-receptor class A domain-containing protein 2 (Fragment) |
| SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
| Gene3D | G3DSA:2.10.70.10 |
| Pfam | PF00629 MAM; MAM domain, meprin/A5/mu |
| SMART | SM00137 |
| ProSiteProfiles | PS50060 MAM_2; MAM domain profile. |
| ProSitePatterns | PS00524 SMB_1; Somatomedin B domain (SMB) signature. |
| PANTHER | PTHR23282 |
You might be interested in these researchers
You might be interested in these references
