Gene detail [Fasta]
Species | Drosophila simulans |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002077090.1 |
sequence |
PEP: >XP_002077090.1 MPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQRRQSKEADPGQEQIEAD |
Swiss-Prot | Cytochrome P450 306a1 |
KEGG | K10720 PHM; CYP306A1; ecdysteroid 25-hydroxylase |
SUPERFAMILY | SSF48264 Cytochrome P450 superfamily |
Gene3D | G3DSA:1.10.630.10 |
Pfam | PF00067 p450; Cytochrome P450 |
PRINTS | PR00385 |
Coils | Coil |
ProSitePatterns | PS00086 CYTOCHROME_P450; Cytochrome P450 cysteine heme-iron ligand signature. |
PANTHER | PTHR24300:SF116 |
You might be interested in these researchers

You might be interested in these references
