Gene detail [Fasta]
| Species | Drosophila simulans |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002077090.1 |
| sequence |
PEP: >XP_002077090.1 MPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQRRQSKEADPGQEQIEAD |
| Swiss-Prot | Cytochrome P450 306a1 |
| KEGG | K10720 PHM; CYP306A1; ecdysteroid 25-hydroxylase |
| SUPERFAMILY | SSF48264 Cytochrome P450 superfamily |
| Gene3D | G3DSA:1.10.630.10 |
| Pfam | PF00067 p450; Cytochrome P450 |
| PRINTS | PR00385 |
| Coils | Coil |
| ProSitePatterns | PS00086 CYTOCHROME_P450; Cytochrome P450 cysteine heme-iron ligand signature. |
| PANTHER | PTHR24300:SF116 |
You might be interested in these researchers
You might be interested in these references
