Gene detail [Fasta]
Species | Drosophila simulans |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002076106.1 |
sequence |
PEP: >XP_002076106.1 MFMFLKRCATRRKGAAVSYKEASEDEATDSEDLLEFEYDESQAATTAAAAEEEEKCETIERILAQRAGKRGCTGNQTTIY |
Swiss-Prot | Chromodomain-helicase-DNA-binding protein 1 |
KEGG | K11367 |
SUPERFAMILY | SSF54160 Chromo domain-like superfamily |
Gene3D | G3DSA:2.40.50.40 |
Pfam | PF00385 Chromo; Chromo (CHRromatin Organisation MOdifier) domain |
SMART | SM00298 |
ProSiteProfiles | PS50013 CHROMO_2; Chromo and chromo shadow domain profile. |
ProSitePatterns | PS00598 CHROMO_1; Chromo domain signature. |
PANTHER | PTHR10799:SF538 |
You might be interested in these researchers

You might be interested in these references
