Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008487778.1 |
sequence |
PEP: >XP_008487778.1 MATNQSIDNESTPVPVSEGTTSQSVSSGLSLVPRLVDHNSLRASWNSVVQETLNAMTRVRNVDPTPARRPMSMTSWLHSR |
Swiss-Prot | RING finger and transmembrane domain-containing protein 2 |
SUPERFAMILY | SSF57850 RING/U-box superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF13923 zf-C3HC4_2; Zinc finger, C3HC4 type (RING finger) |
SMART | SM00184 |
ProSiteProfiles | PS50089 ZF_RING_2; Zinc finger RING-type profile. |
ProSitePatterns | PS00518 ZF_RING_1; Zinc finger RING-type signature. |
You might be interested in these researchers

You might be interested in these references
