Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008487089.1 |
sequence |
PEP: >XP_008487089.1 IHIVETKFDLHILIDIGRQISQGMDYLHAKNIIHRDMKSNNIFLHDGTIKIGDFGLATVKSKWSGGLQYHQPSGSILWMA |
Swiss-Prot | Serine/threonine-protein kinase-transforming protein Rmil |
KEGG | K04365 BRAF; B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1] |
SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
Gene3D | G3DSA:1.10.510.10 |
Pfam | PF07714 Pkinase_Tyr; Protein tyrosine kinase |
SMART | SM00220 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
ProSitePatterns | PS00108 PROTEIN_KINASE_ST; Serine/Threonine protein kinases active-site signature. |
You might be interested in these researchers

You might be interested in these references
