Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008487062.1 |
sequence |
PEP: >XP_008487062.1 MFDADAFSCETCCRGFPTQEQLDTHLGQHVTCGIDGCTLSAHPGILEVHVRFQHRTGLFKEINNAEVDKWIQDRKNRFPT |
Swiss-Prot | Nuclear fragile X mental retardation-interacting protein 1 |
Pfam | PF10453 NUFIP1; Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1) |
SMART | SM00355 |
ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
Coils | Coil |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers

You might be interested in these references
