Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008486467.1 |
sequence |
PEP: >XP_008486467.1 MVDKYLNKKYKLSKSENFDELMKALGVGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDG |
Swiss-Prot | Fatty acid-binding protein, muscle |
KEGG | K08756 FABP7; fatty acid-binding protein 7, brain |
SUPERFAMILY | SSF50814 Lipocalins superfamily |
Gene3D | G3DSA:2.40.128.20 |
Pfam | PF00061 Lipocalin; Lipocalin / cytosolic fatty-acid binding protein family |
PRINTS | PR00178 |
ProSitePatterns | PS00214 FABP; Cytosolic fatty-acid binding proteins signature. |
You might be interested in these researchers

You might be interested in these references
