Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008485255.1 |
sequence |
PEP: >XP_008485255.1 MGDPSPDVVAAVNDPKNGIVNPAFTPPSLLSQQSTVWTRKQQAVCVRHAFKHYGSKSNPNHVLSNLNMTVAKGTIYGLLG |
Swiss-Prot | ABC transporter G family member 23 |
KEGG | K01990 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00005 ABC_tran; ABC transporter |
ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
ProSitePatterns | PS00211 ABC_TRANSPORTER_1; ABC transporters family signature. |
You might be interested in these researchers

You might be interested in these references
